PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold02980-abinit-gene-0.4-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NF-YB
Protein Properties Length: 126aa    MW: 14592.2 Da    PI: 4.7765
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold02980-abinit-gene-0.4-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB163.43.1e-5118113297
                                                 NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrek 58 
                                                           +eq+r+lPianv+rimk+ lP nakisk+aket+qecvsefisfvtseas+kc++e+
  augustus_masked-scaffold02980-abinit-gene-0.4-mRNA-1  18 KEQERLLPIANVGRIMKQSLPLNAKISKEAKETMQECVSEFISFVTSEASEKCRKER 74 
                                                           89******************************************************* PP

                                                 NF-YB  59 rktingddllwalatlGfedyveplkvylkkyrelegek 97 
                                                           rkt+ngdd++wal  lGf+dy  p++ yl++yrele e+
  augustus_masked-scaffold02980-abinit-gene-0.4-mRNA-1  75 RKTVNGDDVCWALEALGFDDYSGPIRRYLHRYRELEVER 113
                                                           ***********************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-5011119IPR009072Histone-fold
SuperFamilySSF471136.99E-3820116IPR009072Histone-fold
PfamPF008083.7E-272387IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.9E-165169No hitNo description
PROSITE patternPS0068505470IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.9E-167088No hitNo description
PRINTSPR006152.9E-1689107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MDDNVGASDP NEDNNNIKEQ ERLLPIANVG RIMKQSLPLN AKISKEAKET MQECVSEFIS  60
FVTSEASEKC RKERRKTVNG DDVCWALEAL GFDDYSGPIR RYLHRYRELE VERANQDRVR  120
DNEREA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4217108192Transcription factor HapC (Eurofung)
4g92_B2e-4217108192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002516901.21e-68PREDICTED: nuclear transcription factor Y subunit B-5
SwissprotO822487e-55NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLB9RT323e-68B9RT32_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGGLYMA07G37840.23e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-56nuclear factor Y, subunit B5